PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA40G00604
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 203aa    MW: 23796.7 Da    PI: 8.2424
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA40G00604genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.3e-191966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l d+vk +G+g+W++Ia++ g++R++k+c++rw +yl
       AA40G00604 19 KGLWTVEEDKILMDYVKSHGKGHWNRIAKKTGLKRCGKSCRLRWMNYL 66
                     678*******************************************97 PP

2Myb_DNA-binding61.61.7e-1972117148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
       AA40G00604  72 RGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 117
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.5451466IPR017930Myb domain
SuperFamilySSF466899.87E-3217113IPR009057Homeodomain-like
SMARTSM007173.3E-151868IPR001005SANT/Myb domain
PfamPF002494.3E-171966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-252073IPR009057Homeodomain-like
CDDcd001671.71E-112266No hitNo description
PROSITE profilePS5129428.73767121IPR017930Myb domain
SMARTSM007175.6E-1971119IPR001005SANT/Myb domain
PfamPF002491.8E-1872117IPR001005SANT/Myb domain
CDDcd001675.23E-1374117No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2874121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045165Biological Processcell fate commitment
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MRKKLSNSGE EGNNNDYKKG LWTVEEDKIL MDYVKSHGKG HWNRIAKKTG LKRCGKSCRL  60
RWMNYLSPNV KRGNFTEQEE DLIIRLHKLL GNRWSLIAKR VPGRTDNQVK NYWNTHLSKK  120
LEIKDETIKT INNDDDIVHQ INIQNPDDTN EEKISNIKDN DNIFGNHEIH GNRQGSNYLS  180
SLWIHEDEFE LSTLTNMMDF IDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30161224109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196979.11e-117transcription factor WER
RefseqXP_006288682.11e-117hypothetical protein CARUB_v10001990mg
SwissprotQ9SEI01e-119WER_ARATH; Transcription factor WER
TrEMBLC0SVP61e-117C0SVP6_ARATH; Putative uncharacterized protein At5g14750 (Fragment)
TrEMBLR0H9F81e-117R0H9F8_9BRAS; Uncharacterized protein
STRINGAT5G14750.11e-117(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-121myb domain protein 66